Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d015985_circ_g.3 |
ID in PlantcircBase | zma_circ_008667 |
Alias | zma_circ_0001877 |
Organism | Zea mays |
Position | chr5: 136813496-136820814 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d015985 |
Parent gene annotation |
Probable tocopherol cyclase, chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d015985_circ_g.1 Zm00001d015985_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d015985_T008:2 Zm00001d015985_T009:2 Zm00001d015985_T003:2 Zm00001d015985_T005:2 Zm00001d015985_T006:2 Zm00001d015985_T004:2 Zm00001d015985_T001:2 Zm00001d015985_T007:2 Zm00001d015985_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.133832828 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
136820789-136820811(+) |
Potential amino acid sequence |
MSGENKTHLIQCNVFPGASGEVSLTAAGGLRKIGLGDTYESPSLIGIHYEGQFFEFVPWTGTVS WDIGLWGLWKMSGENKTHLIQCNVFPGASGEVSLTAAGGLRKIGLGDTYESPSLIGIHYEGQFF EFVPWTGTVSWDIGLWGLWKMSGENKTHLIQCNVFPGASGEVSLTAAGGLRKIGLGDTYESPSL IGIHYEGQFFEFVPWTGTVSWDIGLWGLWKMSGENKTHL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |