Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0214900_circ_g.4 |
| ID in PlantcircBase | osa_circ_030187 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 5843182-5843928 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0214900 |
| Parent gene annotation |
FAD-dependent pyridine nucleotide-disulphide oxidoreductase doma in containing protein. (Os06t0214900-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0214900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127600993 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5843262-5843222(+) 5843200-5843846(-) 5843868-5843922(-) |
| Potential amino acid sequence |
MHTRGRCLSGQEYIGIGPSSVDEGREKPPSPELLEAMSLNNLDGSPNFIGVPPSLHELLRIEFL HTFKPPEASYHWAIQEILI*(+) MIRSLRRFECMEEFNPQQFMEAWWYANEVWTTI*(-) MKFGLPSRLFRLMASSSSGDGGFSRPSSTDEGPMPIYSWPDKQRPRVCILGGGFGGLYTALRLE SLVWPNDKKPQEV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |