Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_17G259400_circ_g.3 |
| ID in PlantcircBase | gma_circ_004604 |
| Alias | Gm17circRNA1321, gma-circRNA2413 |
| Organism | Glycine max |
| Position | chr17: 41356585-41356841 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, find_circ |
| Parent gene | GLYMA_17G259400 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_17G259400_circ_g.1 GLYMA_17G259400_circ_g.2 |
| Support reads | NA |
| Tissues | root, flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH05975:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.527624935 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41356840-41356838(+) 41356802-41356603(+) 41356620-41356794(-) |
| Potential amino acid sequence |
MVPDEAVLKCTACGVDFGAFLRRHHCRNCGDIFCDKCTRGRIALTSDEDALQVRVCDRCMVPDE AVLKCTACGVDFGAFLRRHHCRNCGDIFCDKCTRGRIALTSDEDALQVRVCDRCMVPDEAVLKC TACGVDFGAFLRRHHCRNCGDIFCDKCTRGRIALTSDEDALQVRVCDRCM(+) MRMLCKYEFVIDAWSQMKQS*(+) MLYILRLLHLGPCIDHKLVLAEHPHQK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Chen et al., 2018 |