Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0465500_circ_g.1 |
ID in PlantcircBase | osa_circ_014606 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 15652823-15654356 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0465500 |
Parent gene annotation |
Exonuclease domain containing protein. (Os02t0465500-01) |
Parent gene strand | - |
Alternative splicing | Os02g0465500_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0465500-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.117661012 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15654295-15652843(+) 15654281-15654344(-) |
Potential amino acid sequence |
MMIQEILHRNLVPTCHSAHFHLCLCVML*(+) MPLVWIDLEMTGLDVAKDRILEIACIITDGKLTKQIEGPDLVINQKKDLLDNMDEWCKTHHAAS GLTQRVLQSTISEHDAETQVKMR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |