Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0473000_circ_g.3 |
| ID in PlantcircBase | osa_circ_009333 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 16307672-16309010 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0473000 |
| Parent gene annotation |
Similar to ER lumen protein retaining receptor (HDEL receptor) ( PGP169-12). (Os11t0473000-01);Similar to ER lumen protein retain ing receptor (HDEL receptor) (PGP169-12). (Os11t0473000-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0473000_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0473000-02:4 Os11t0473000-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.15032584 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16307768-16307756(+) 16307677-16308503(-) |
| Potential amino acid sequence |
MKLVFLASSFSIVWYMRRHKIVRRTYDKDHDTFRHHFLVLPCLALALLINERFTFREVMWAFSI YLEAVAILPQLVLLQRTRNIDNLTGQYVFFLGAYRVLYILNWIYRYFTEPHFVHWISWVAGIVQ TLLYADFFYYYIMRHISKDPGAICTCVCCSLLGPVHSFYISV*(+) MPHYVIVEEVSIQESLHDARNPAYPMNEMGLSEVSVDPVKDIQHTVCT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |