Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0473000_circ_g.3 |
ID in PlantcircBase | osa_circ_009333 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 16307672-16309010 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0473000 |
Parent gene annotation |
Similar to ER lumen protein retaining receptor (HDEL receptor) ( PGP169-12). (Os11t0473000-01);Similar to ER lumen protein retain ing receptor (HDEL receptor) (PGP169-12). (Os11t0473000-02) |
Parent gene strand | + |
Alternative splicing | Os11g0473000_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0473000-02:4 Os11t0473000-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.15032584 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16307768-16307756(+) 16307677-16308503(-) |
Potential amino acid sequence |
MKLVFLASSFSIVWYMRRHKIVRRTYDKDHDTFRHHFLVLPCLALALLINERFTFREVMWAFSI YLEAVAILPQLVLLQRTRNIDNLTGQYVFFLGAYRVLYILNWIYRYFTEPHFVHWISWVAGIVQ TLLYADFFYYYIMRHISKDPGAICTCVCCSLLGPVHSFYISV*(+) MPHYVIVEEVSIQESLHDARNPAYPMNEMGLSEVSVDPVKDIQHTVCT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |