Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G29660_circ_g.6 |
| ID in PlantcircBase | ath_circ_004824 |
| Alias | At_ciR443 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 10372595-10372840 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, find_circ, circseq_cup, CIRI-full |
| Parent gene | AT1G29660 |
| Parent gene annotation |
GDSL esterase/lipase At1g29660 |
| Parent gene strand | + |
| Alternative splicing | AT1G29660_circ_g.1 AT1G29660_circ_g.2 AT1G29660_circ_g.3 1_circ_ag.4 AT1G29660_circ_g.5 AT1G29670_circ_g.1 |
| Support reads | 17/84 |
| Tissues | leaf/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G29660.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.289246161 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10372721-10372837(+) |
| Potential amino acid sequence |
MGSNDYLNNYFMPQFYSTSRQYTPEQYADDLISRYRDQLNGQRITFSGQVENYKNTVAQVVEIL GDEYTAADYLKRCIYSVGMGSNDYLNNYFMPQFYSTSRQYTPEQYADDLISRYRDQLNGQRITF SGQVENYKNTVAQVVEILGDEYTAADYLKRCIYSVGMGSNDYLNNYFMPQFYSTSRQYTPEQYA DDLISRYRDQLNGQRITFSGQVENYKNTVAQVVEILGDEYTAADYLKRCIYSVGMGSNDYLNNY FMPQFYSTSRQYTPEQYADDLISRYRDQLN(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |