Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0659900_circ_g.2 |
| ID in PlantcircBase | osa_circ_025787 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 33669754-33670091 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0659900 |
| Parent gene annotation |
Similar to OSIGBa0132E09-OSIGBa0108L24.21 protein. (Os04t0659900 -01);Similar to OSIGBa0132E09-OSIGBa0108L24.21 protein. (Os04t06 59900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0659900-01:1 Os04t0659900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.312915311 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33670000-33669777(+) 33669787-33670006(-) 33669758-33670019(-) |
| Potential amino acid sequence |
MHYLICLQAFLKHIDFEVVQCAVIASPGFTKHNSNQSTY*(+) MFQYVLWLLLCLVKPGLAITAHWTTSKSICFRKACRQIK*(-) MLSKTWACNYSTLDYFKINMLQESL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |