Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0485000_circ_g.4 |
| ID in PlantcircBase | osa_circ_007189 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 18326102-18327117 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0485000 |
| Parent gene annotation |
FF domain containing protein. (Os10t0485000-01) |
| Parent gene strand | - |
| Alternative splicing | Os10g0485000_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0485000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.199737935 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18327089-18326149(+) 18326595-18327099(-) |
| Potential amino acid sequence |
MLQSVPASLSLKTWIKHYFWEFLFPL*(+) MGHQVSISGEKSKDNSGDGNMSDSSSNSDDEEHGPSEEECTRQFKEMLKERGVLPFSKWEKELP KIVFDPRFKGQTGWH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |