Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0733600_circ_g.4 |
ID in PlantcircBase | osa_circ_003781 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 30595834-30597044 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0733600 |
Parent gene annotation |
Flavoprotein pyridine nucleotide cytochrome reductase domain con taining protein. (Os01t0733600-01) |
Parent gene strand | - |
Alternative splicing | Os01g0733600_circ_g.1 Os01g0733600_circ_g.2 Os01g0733600_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0733700-00:4 Os01t0733700-00:4 Os01t0733600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.125822048 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30596981-30595840(+) 30596967-30597041(-) |
Potential amino acid sequence |
MELFDSVIPTKTATRDLELLHIVM*(+) MYDIINPDLSVLGDAKVEVIYHSSDEAQQDSNLLDFKNLIQRARSMSPSLQFYNNDKEPHYMLQ MVSNRCLTKENSDRDVRHFELENPSSGITYQVGDALEILPSQSPSAVDSFIERCKLDPDCYITI *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |