Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0784700_circ_g.2 |
| ID in PlantcircBase | osa_circ_016837 |
| Alias | Os_ciR8156 |
| Organism | Oryza sativa |
| Position | chr2: 33315994-33316169 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0784700 |
| Parent gene annotation |
Similar to 26S protease regulatory subunit 7 (Fragment). (Os02t0 784700-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0784700-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.337173201 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33316054-33316071(+) 33316056-33316158(-) |
| Potential amino acid sequence |
MVRVCILNIWVRPSRSGKPNSTFLSKRPGRRSAGSKVSGQLSWGRGEPAARNGYRAHSSWCVYV S*(+) MNCERDIRFELLARLCPNSTGLIP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |