Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G35690_circ_g.1 |
| ID in PlantcircBase | ath_circ_041147 |
| Alias | Ath_circ_FC3574 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 13866560-13866829 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT5G35690 |
| Parent gene annotation |
Putative uncharacterized protein At5g35690 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G35690.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.241093165 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13866809-13866562(-) |
| Potential amino acid sequence |
MTELAPVGYVGVSPRCLLGFNKNQGEEISLRLRTDDLKGFRKYQSIKKTLLHELHRWRVGIMTE LAPVGYVGVSPRCLLGFNKNQGEEISLRLRTDDLKGFRKYQSIKKTLLHELHRWRVGIMTELAP VGYVGVSPRCLLGFNKNQGEEISLRLRTDDLKGFRKYQSIKKTLLHELHRWRVGIMTELAPVGY VGVSPRCLLGFNKNQGEEISLRLRTDDLKGFRKYQSIKKTLLHEL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |