Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0285800_circ_g.7 |
ID in PlantcircBase | osa_circ_014295 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 10741561-10742526 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0285800 |
Parent gene annotation |
Similar to GTP-binding protein typA (Tyrosine phosphorylated pro tein A). (Os02t0285800-01);Similar to predicted protein. (Os02t0 285800-02) |
Parent gene strand | + |
Alternative splicing | Os02g0285800_circ_g.1 Os02g0285800_circ_g.2 Os02g0285800_circ_g.3 Os02g0285800_circ_g.4 Os02g0285800_circ_g.5 Os02g0285800_circ_g.6 Os02g0285800_circ_g.8 Os02g0285800_circ_g.9 Os02g0285800_circ_g.10 Os02g0285800_circ_g.11 Os02g0285800_circ_g.12 Os02g0285800_circ_g.13 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0285800-02:2 Os02t0285800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.142094444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10742516-10742523(+) |
Potential amino acid sequence |
MEVKCDFQTVYASGIKGKAGLSPENLGDDLGPLFEAILRCIPEPRIEKDGALQLLVSNTEYDEH KGRIAIGRLHAGELQRGMEVKCDFQTVYASGIKGKAGLSPENLGDDLGPLFEAILRCIPEPRIE KDGALQLLVSNTEYDEHKGRIAIGRLHAGELQRGMEVKCDFQTVYASGIKGKAGLSPENLGDDL GPLFEAILRCIPEPRIEKDGALQLLVSNTEYDEHKGRIAIGRLHAGELQRGMEVK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |