Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0264900_circ_g.4 |
| ID in PlantcircBase | osa_circ_033368 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 9401017-9402567 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0264900 |
| Parent gene annotation |
Similar to FAD binding protein. (Os07t0264900-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0264900_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0264900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.203152235 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9402525-9401059(+) 9401095-9401067(+) 9401023-9402479(-) |
| Potential amino acid sequence |
MIALMIIVLQIFFLRTFSKTKTPHRVRCN*(+) MRSYLEAGCTHHNETIQNMNKLHSCQEKLNDHISKAKLLLEELHILEEDVYSTTLKACLSSLRH MDDCPDDNSLTNIFSENIFEDQNSSQSQVQLVR*(+) MFSEKIFVRLLSSGQSSICLKELRQAFSVVL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |