Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G157100_circ_g.1 |
| ID in PlantcircBase | gra_circ_000278 |
| Alias | Chr03:42672823|42673111 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 42672823-42673111 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G157100 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.003G157100.5:2 Gorai.003G157100.6:2 Gorai.003G157100.3:2 Gorai.003G157100.2:2 Gorai.003G157100.8:1 Gorai.003G157100.1:2 Gorai.003G157100.7:1 Gorai.003G157100.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.106978085 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42672899-42673106(-) 42672870-42673005(-) |
| Potential amino acid sequence |
MDADGTQGFVCRTLGFAGLWNSMLLGV*(-) MSNSGFRWPLELDATRSLKCLQYLRNELVSSLAKFTFRYRKTNTIQSESVR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |