Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G33040_circ_g.4 |
| ID in PlantcircBase | ath_circ_016204 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14020241-14020393 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G33040 |
| Parent gene annotation |
ATP synthase subunit gamma, mitochondrial |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 15 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G33040.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.475487146 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14020383-14020243(-) |
| Potential amino acid sequence |
MKSVKNIQKITKAMKMVAASKLRAVQGRAENSRGLWQPFTALLGDNPMRNRMKSVKNIQKITKA MKMVAASKLRAVQGRAENSRGLWQPFTALLGDNPMRNRMKSVKNIQKITKAMKMVAASKLRAVQ GRAENSRGLWQPFTALLGDNPMRNRMKSVKNIQKITKAMKMVAASKLRAVQGRAENSRGLWQPF TALLGDNP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |