Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0274900_circ_g.1 |
ID in PlantcircBase | osa_circ_014244 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 10075103-10075387 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0274900 |
Parent gene annotation |
Major facilitator superfamily protein. (Os02t0274900-01);Similar to metabolite transport protein csbC. (Os02t0274900-02);Similar to metabolite transport protein csbC. (Os02t0274900-03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0274900-02:2 Os02t0274900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.307717982 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10075109-10075121(+) 10075329-10075359(-) |
Potential amino acid sequence |
MRWKLKSSAYKRVPSRDAAMDLDVETPAKMADGGAPSWRMSLPHVCVATLTSFLFGYHSGADAV EA*(+) MRHDGAPPSAIFAGVSTSRSMAASLDGTRLYADDLSFHRIGAGVVAEEEGGERGDAHVRQRHAP RRGPAVRHFRWRLDVEIHGGVPGRHALVRRRLKLPPHRRRSGSRRGRR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |