Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0622300_circ_g.2 |
| ID in PlantcircBase | osa_circ_031404 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 25017703-25018993 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os06g0622300 |
| Parent gene annotation |
AT-rich interaction domain-containing protein, Shoot apical meri stem (SAM) development (Os06t0622300-01);Hypothetical conserved gene. (Os06t0622300-02);Similar to DNA-binding protein. (Os06t06 22300-03);Similar to DNA-binding protein. (Os06t0622300-04) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0622300-03:5 Os06t0622300-04:5 Os06t0622300-02:5 Os06t0622300-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.237537393 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25018962-25018045(+) 25018348-25018954(-) |
| Potential amino acid sequence |
MVLYKMKRNMQVLPRGKGHRPWKMTGLYHINLTSYKMTQWFLTLALQLIG*(+) MHRLHSNLWFSERLSLPNQLEGQGQEPLSHFVACQVYMVQSCHLPRSVSFSSWQNLHVALHLVE HHLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |