Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0520700_circ_g.8 |
ID in PlantcircBase | osa_circ_039886 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 20344744-20345669 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os09g0520700 |
Parent gene annotation |
Similar to RNA helicase. (Os09t0520700-01);Similar to DEAD/DEAH box helicase family protein. (Os09t0520700-02) |
Parent gene strand | + |
Alternative splicing | Os09g0520700_circ_g.7 |
Support reads | 95 |
Tissues | root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0520700-01:4 Os09t0520700-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018656 |
PMCS | 0.158471913 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20345505-20344781(+) 20344832-20345521(-) |
Potential amino acid sequence |
MMCSLSFSVNLHVMLKPTYTGQVGLGEQLSLRFLKSGKKTVDLVGDEKLKASASVRHLALPCNR AARAQVIPDIIRCYSRGGRTIIFTETKESASDLSGLIAGSRALHGDVAQAQREVILAGFRSGKF LVLVATNVAARGLDINDVQLIIQCEPPRDVEAYIHRSGRTGRAALLEISQIWKENG*(+) MPNRCTSFQFLISNKINRFLSRFEKSQGELLSQSDLTGVCRLQHHVEVHTE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |