Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0520700_circ_g.8 |
| ID in PlantcircBase | osa_circ_039886 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 20344744-20345669 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os09g0520700 |
| Parent gene annotation |
Similar to RNA helicase. (Os09t0520700-01);Similar to DEAD/DEAH box helicase family protein. (Os09t0520700-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0520700_circ_g.7 |
| Support reads | 95 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0520700-01:4 Os09t0520700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018656 |
| PMCS | 0.158471913 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20345505-20344781(+) 20344832-20345521(-) |
| Potential amino acid sequence |
MMCSLSFSVNLHVMLKPTYTGQVGLGEQLSLRFLKSGKKTVDLVGDEKLKASASVRHLALPCNR AARAQVIPDIIRCYSRGGRTIIFTETKESASDLSGLIAGSRALHGDVAQAQREVILAGFRSGKF LVLVATNVAARGLDINDVQLIIQCEPPRDVEAYIHRSGRTGRAALLEISQIWKENG*(+) MPNRCTSFQFLISNKINRFLSRFEKSQGELLSQSDLTGVCRLQHHVEVHTE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |