Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G023800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000016 |
| Alias | Chr01:2238726|2240474 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 2238726-2240474 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G023800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.001G023800.3:1 Gorai.001G023800.5:1 Gorai.001G023800.1:1 Gorai.001G023800.4:1 Gorai.001G023800.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.096918777 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2240408-2238772(+) 2240101-2238732(+) |
| Potential amino acid sequence |
MDILTSVNDLLLLKLRHLSAFSDTLEEIGGKFFAGSDN*(+) MEKDALRINNSGIGNSINYSRDRNGGAGDGGLLRSSSDPAKQTASSSDFVLQWGNRKRLRCMKI QVKDDQSGPVNRTTVRVDRRVVRADKDSSNQPSNNNHGNGYFNLRQRPASPQAPPSQRVLRYT* (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |