Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0222300_circ_g.2 |
| ID in PlantcircBase | osa_circ_033230 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 6764108-6766388 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0222300 |
| Parent gene annotation |
Eukaryotic translation initiation factor 3 subunit E, Organ grow th and pollen development (Os07t0222300-01);Similar to Eukaryoti c initiation factor 3e. (Os07t0222300-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0222300-01:5 Os07t0222300-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.128331923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6766225-6766261(-) |
| Potential amino acid sequence |
MQNWDVALDELNRLKEIIDSKNFSSPLNQLQNRIWLMHWSIFIFFNHENGRNGIIDLFFQDRYL NAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLYVNYDFDGAQQ KLIECEQVILNDPFLGKRIEEGNFVTVPLRDEFLENARLFIFETYCRIHRCIDIGMLSQKLNMS YDEAELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNILVLSRLRLCISLPSFSLTAVITQMLLS TCINTVLCARTARGA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |