Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0658500_circ_g.1 |
| ID in PlantcircBase | osa_circ_031829 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 27070754-27072842 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os06g0658500 |
| Parent gene annotation |
Conserved hypothetical protein. (Os06t0658500-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0658500-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.101085408 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27070978-27070760(+) |
| Potential amino acid sequence |
MKDYSEASLAIISEIEPKDAIMQLLKQETYSRSECNALVKIIQERVVDSNLNGVDAGGLALPIN WKTGRQANIGYSSLSPKGLLPATSIPPVQDHVFDNSAGAGASTTIAHDRGPFAHATDKIQSVLK RSCSVATDTPDPEDSRRVRPKINGNSLEISNFKQVDVIRTHSGDDNKLSDVPLFGTNNLIYSNI VSIVGSADEKIGIPNKPSAGDGNKNYDSEFLNPCTNKDLKNSFPLKVEPLDVCIPFEQQMMDLS HQKHEHAACDDYCSVSKLMFKEDIETALRSW*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |