Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0016s11790_circ_g.1 |
| ID in PlantcircBase | pop_circ_003899 |
| Alias | Chr16:11301213-11301865 |
| Organism | Populus trichocarpa |
| Position | chr16: 10956843-10957495 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0016s11790 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | POPTR_0016s11790.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.252689944 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10956928-10956846(+) 10957003-10957486(-) |
| Potential amino acid sequence |
MFMGHQKGRNTKENIMRNFGMPTPHGYRKALRMMYYADHHGFPIVTFIDTPGAYADLKSEELGQ GEAIAHNLRTMFGLKVPIVSIVIGEGGSGGALAIGCANKLLMLENAVFYVASL*(+) MRSRHPKVTHNVLFCVSSLLVTHEHVSSTIYCAYTSNNSRIIISCTISMKLYKLAT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |