Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0729300_circ_g.1 |
| ID in PlantcircBase | osa_circ_032505 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 31076139-31076452 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0729300 |
| Parent gene annotation |
Similar to AGO1 homologous protein. (Os06t0729300-01);Similar to Protein argonaute 1D. (Os06t0729300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0729300-01:2 Os06t0729300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.172534448 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31076234-31076175(+) |
| Potential amino acid sequence |
MIRIQSTGVGTYCLVLLLTPRFAILRSLTSSCAAMLESRLVHHSKQITNRR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |