Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0168700_circ_g.1 |
| ID in PlantcircBase | osa_circ_010612 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 3484799-3485327 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0168700 |
| Parent gene annotation |
AMP-dependent synthetase and ligase domain containing protein. ( Os12t0168700-01);AMP-dependent synthetase and ligase domain cont aining protein. (Os12t0168700-02);Similar to LACS9 (LONG CHAIN A CYL-COA SYNTHETASE 9); long-chain-fatty-acid-CoA ligase. (Os12t0 168700-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0168700-02:1 Os12t0168700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.327257309 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3484879-3484819(+) 3484867-3485286(-) 3484844-3485266(-) |
| Potential amino acid sequence |
MNPYFVGLLVPIAVSLLLRKRRMVGKMRALPVDVGGEPGYAIRNYRFKQPVETHWEGVTTLAEL FEQSCKDYVNMPLLGTRKLISREQESSLDGRSFEKLHLGEYDWKCYAEVFKSVCNFASGLIRLG HQKTDRVAIFAETRAEWQIALQVSSSVHM*(+) MLSALNYIWEVKYSFTCALKKKPAEQFATQPASRRK*(-) MGGEVQFHMCTEEETCRAICHSARVSAKIATRSVF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |