Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d041073_circ_g.2 |
| ID in PlantcircBase | zma_circ_007604 |
| Alias | zma_circ_0001517 |
| Organism | Zea mays |
| Position | chr3: 95293563-95295275 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d041073 |
| Parent gene annotation |
E3 ubiquitin-protein ligase RGLG1 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d041073_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d041073_T002:5 Zm00001d041073_T001:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.056606237 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
95293593-95293583(+) 95293607-95295234(-) |
| Potential amino acid sequence |
MATTIVEQSGGQYHVLVIIADGQVTRSVDTEFGQLSTQEQMTVDAIVQASQFPLSIILVGVGDG PWDMMKEFDDNIPARSFDNFQFVNFTAIMSKKISQSKKETEFALSALMEIPLQYKATLELGILG RRIGESPERIPLPPPFASYSTVSRAEPSRANSYRSVPSHPREEPAVNSTITASVTSPSAAESRV LEPQVLRHSPQ*(+) MVVAMSIIGANDVGPGVLKLYFRQLMGM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |