Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G39850_circ_g.5 |
ID in PlantcircBase | ath_circ_035763 |
Alias | At_ciR4337 |
Organism | Arabidpsis thaliana |
Position | chr4: 18492882-18493037 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT4G39850 |
Parent gene annotation |
Peroxisomal ABC transporter 1 |
Parent gene strand | + |
Alternative splicing | AT4G39850_circ_g.6 AT4G39850_circ_g.7 AT4G39850_circ_g.8 AT4G39850_circ_g.9 AT4G39850_circ_g.10 AT4G39850_circ_g.11 AT4G39850_circ_g.12 AT4G39850_circ_g.13 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G39850.4:1 AT4G39850.2:1 AT4G39850.1:1 AT4G39850.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.294567213 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18493023-18493034(+) |
Potential amino acid sequence |
MLNVLESATNSKAQSYQTQLIARSPVVDKSVVLPRFPQPQTSQRALPSRVAAMLNVLESATNSK AQSYQTQLIARSPVVDKSVVLPRFPQPQTSQRALPSRVAAMLNVLESATNSKAQSYQTQLIARS PVVDKSVVLPRFPQPQTSQRALPSRVAAMLNVL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |