Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G39850_circ_g.5 |
| ID in PlantcircBase | ath_circ_035763 |
| Alias | At_ciR4337 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 18492882-18493037 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT4G39850 |
| Parent gene annotation |
Peroxisomal ABC transporter 1 |
| Parent gene strand | + |
| Alternative splicing | AT4G39850_circ_g.6 AT4G39850_circ_g.7 AT4G39850_circ_g.8 AT4G39850_circ_g.9 AT4G39850_circ_g.10 AT4G39850_circ_g.11 AT4G39850_circ_g.12 AT4G39850_circ_g.13 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G39850.4:1 AT4G39850.2:1 AT4G39850.1:1 AT4G39850.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.294567213 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18493023-18493034(+) |
| Potential amino acid sequence |
MLNVLESATNSKAQSYQTQLIARSPVVDKSVVLPRFPQPQTSQRALPSRVAAMLNVLESATNSK AQSYQTQLIARSPVVDKSVVLPRFPQPQTSQRALPSRVAAMLNVLESATNSKAQSYQTQLIARS PVVDKSVVLPRFPQPQTSQRALPSRVAAMLNVL(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |