Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0179200_circ_g.1 |
ID in PlantcircBase | osa_circ_000520 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 4120359-4121385 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0179200 |
Parent gene annotation |
Syntaxin, N-terminal domain containing protein. (Os01t0179200-01 ) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0179200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_001839* |
PMCS | 0.420462528 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4120563-4120380(+) |
Potential amino acid sequence |
MSATKEFKEVLTMRTENLKVHENRRQMFSSSAANNASNPFVRQRPLVTRDGPESSVPPAPWASD SATTPLFQRKKTNGDHGASSSSSQPFMQQQLVQQDSYMQSRAEALQNVESTIHELSNIFTQLAT MVSQQGELAISGKEDICF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |