Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0179200_circ_g.1 |
| ID in PlantcircBase | osa_circ_000520 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 4120359-4121385 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0179200 |
| Parent gene annotation |
Syntaxin, N-terminal domain containing protein. (Os01t0179200-01 ) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0179200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_001839* |
| PMCS | 0.420462528 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4120563-4120380(+) |
| Potential amino acid sequence |
MSATKEFKEVLTMRTENLKVHENRRQMFSSSAANNASNPFVRQRPLVTRDGPESSVPPAPWASD SATTPLFQRKKTNGDHGASSSSSQPFMQQQLVQQDSYMQSRAEALQNVESTIHELSNIFTQLAT MVSQQGELAISGKEDICF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |