Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d028187_circ_g.1 |
| ID in PlantcircBase | zma_circ_006435 |
| Alias | zma_circ_0000489 |
| Organism | Zea mays |
| Position | chr1: 25757347-25759017 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d028187 |
| Parent gene annotation |
Heparanase-like protein 1 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d028187_T004:4 Zm00001d028187_T002:3 Zm00001d028187_T001:4 Zm00001d028187_T003:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.079500234 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25758484-25757355(+) |
| Potential amino acid sequence |
MQLTIQRHGTWASAWVSESGGVFNNGGQLVSNTFINSIWYLDQLGMASKYNTKVFCRQTLIGGN YGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINAPRQIRAYAHCRKQQAMS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |