Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0672700_circ_g.2 |
| ID in PlantcircBase | osa_circ_015943 |
| Alias | Os02circ21163/Os_ciR3342 |
| Organism | Oryza sativa |
| Position | chr2: 27369997-27370365 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl, find_circ |
| Parent gene | Os02g0672700 |
| Parent gene annotation |
DNA-directed RNA polymerase, M/15 kDa subunit domain containing protein. (Os02t0672700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/3/3 |
| Tissues | leaf/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0672700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.383965673 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27370056-27370281(+) 27370349-27370354(+) |
| Potential amino acid sequence |
MEFCPGCGMLLQIQPATGGNRLRFYCPTCPYVCPVKNKIVKKARLVKKEVEPIFSDSDAMKNAP KTTRFSVGSSLHRSAGRRIPRRRWSSARGAGCCCRSSRPPAGTACASTAPPAPTSAPSKTRS*( +) MPLRPPGLASDPVSTGARGGGFQGGDGVLPGVRDAAADPAGHRREPPALLLPHLPLRLPRQKQD REEGETSEEGGGAHLQRQRRHEECP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |