Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0510700_circ_g.4 |
| ID in PlantcircBase | osa_circ_039785 |
| Alias | Os_ciR11882 |
| Organism | Oryza sativa |
| Position | chr9: 19828843-19829765 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0510700 |
| Parent gene annotation |
Similar to GCN4-complementing protein homolog. (Os09t0510700-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0510700_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0510700-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.151539364 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19829402-19829016(+) 19829708-19828849(+) 19828888-19829765(-) |
| Potential amino acid sequence |
MTGPPKATLIGSLCPPPNASSELANAISPSYASPSPSLVIEKASLVKTLPGILHIMQINVHKLQ QLVI*(+) MLPVNLQMQYLHHMLPLVLHWS*(+) MPGSVLTRLAFSMTSEGLGEAYDGDIAFASSLEAFGGGHNDPISVAFGGPVMTKFTIALREIGT YKEVLRSQVENMLNDKLLQFVDIDLHDVKDARKRFDKASLLYDQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |