Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0535000_circ_g.2 |
| ID in PlantcircBase | osa_circ_024684 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 26733889-26736826 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder |
| Parent gene | Os04g0535000 |
| Parent gene annotation |
Hypothetical protein. (Os04t0535000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0535000-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.114820354 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26736811-26734000(+) 26734236-26736804(-) |
| Potential amino acid sequence |
MLERKSAQERAGIVGQCTERRQLKLCIVKLVVNVKMDQLLVLT*(+) MITRSGQESVVTTSVLLKHSLTDVLWEFMSIPIVDPSLHSPPTSRYTVLIASFLCIVLQFQLSP VRFSFPACR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |