Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0624700_circ_g.7 |
| ID in PlantcircBase | osa_circ_034847 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 25880640-25880757 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0624700 |
| Parent gene annotation |
UMP/CMP kinase a (EC 2.7.1.48). (Os07t0624700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0624700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.443632768 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25880719-25880689(+) 25880645-25880648(-) |
| Potential amino acid sequence |
MLAHCVPFPLPGPPILRTRFYLCTQKVSST*(+) MGGPGSGKGTQCANIVEHFGFTHLSAGDLLRAEIKSGSENGWSWKWKRHTVCQHCGTLWIHPLK CWRPFACRDKIWF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |