Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0177000_circ_g.30 |
ID in PlantcircBase | osa_circ_036109 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 4507043-4507276 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0177000 |
Parent gene annotation |
Hypothetical protein. (Os08t0177000-01) |
Parent gene strand | + |
Alternative splicing | Os08g0177000_circ_g.29 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0176900-01:2 Os08t0176900-02:1 Os08t0176900-01:2 Os08t0176900-02:1 Os08t0177000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.213604202 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4507233-4507087(+) 4507248-4507245(-) |
Potential amino acid sequence |
MRQLHPARLQVLDVSLNRWALVGWLGCCCG*(+) MKLAHLEQEITRARQQSAYINRSSNPATLPAPIDSGLHPEPGDEPDEAGASGAGDHPSKATERV HQPQQQPSHPTSAHRFRLTSRTWRRAG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |