Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0272900_circ_g.1 |
| ID in PlantcircBase | osa_circ_038683 |
| Alias | Os09circ01814 |
| Organism | Oryza sativa |
| Position | chr9: 5480772-5483601 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os09g0272900 |
| Parent gene annotation |
Disease resistance protein domain containing protein. (Os09t0272 900-01);Hypothetical conserved gene. (Os09t0272900-02) |
| Parent gene strand | - |
| Alternative splicing | Os09g0272900_circ_g.2 Os09g0272900_circ_g.3 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0272900-01:1 Os09t0272900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.203125786 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5483595-5481312(+) 5480776-5483535(-) |
| Potential amino acid sequence |
MHTMDETHHRTAQRNHYDTILRRGSSIGLIPSSSHSRLSHHSTLSEYITCNLGGKLCCRRKGSL LRFSQFVTLRLFRDGNVTSESHMLTNPSLFANSIETRRGNVSIDCIELSCFDMFRMACLILPQP CTHSSSRKGKCSAHEISSSWSQSMVYRTVSLWKSNSGRIPFHVITFRFSKNCKSS*(+) MVCIIKNGTNFGWSSQHCCNTDL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |