Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0244800_circ_g.3 |
| ID in PlantcircBase | osa_circ_023179 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 9368680-9368755 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os04g0244800 |
| Parent gene annotation |
Heavy metal transport/detoxification protein domain containing p rotein. (Os04t0244800-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0244800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.300700768 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9368686-9368703(+) 9368748-9368717(-) |
| Potential amino acid sequence |
MSSRAFLIFLSQPSQSIRTFISTVFHVLKGLLDLPFTAFAVYPHLHLHCLSCPQGPS*(+) MKVRIDCEGCERKIKKALEDMKDSGDEGADRLRRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |