Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G02510_circ_g.1 |
| ID in PlantcircBase | ath_circ_019309 |
| Alias | At_ciR5823 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 522372-522813 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT3G02510 |
| Parent gene annotation |
Putative uncharacterized protein At3g02510 |
| Parent gene strand | - |
| Alternative splicing | AT3G02510_circ_g.2 AT3G02510_circ_g.3 AT3G02510_circ_g.4 AT3G02510_circ_g.5 AT3G02510_circ_g.6 AT3G02510_circ_g.7 AT3G02510_circ_g.8 AT3G02510_circ_g.9 AT3G02510_circ_g.10 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G02510.2:2 AT3G02510.3:3 AT3G02510.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257466553 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
522587-522374(-) |
| Potential amino acid sequence |
MVPQKVNLLAEEDIIQVSCGGTHSVALTRDGRIFSVDIAAGGWHSTALTDKGEVYGWGRGEHGR LGLGDNDKSSKMVPQKVNLLAEEDIIQVSCGGTHSVALTRDGRIFSVDIAAGGWHSTALTDKGE VYGWGRGEHGRLGLGDNDKSSKMVPQKVNLLAEEDIIQVSCGGTHSVALTRDGRIFSVDIAAGG WHSTALTDKGEVYGWGRGEHGRLGLGDNDKSSKMVPQKVNLLAEEDIIQVSCGGTHSVALTRDG RIFS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |