Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d020036_circ_g.5 |
ID in PlantcircBase | zma_circ_009310 |
Alias | Zm07circ00041 |
Organism | Zea mays |
Position | chr7: 87404855-87434480 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d020036 |
Parent gene annotation |
Embryonic flower 2; VEF family protein |
Parent gene strand | + |
Alternative splicing | Zm00001d020036_circ_g.6 Zm00001d020036_circ_g.7 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d020036_T002:10 Zm00001d020036_T003:10 Zm00001d020036_T004:10 Zm00001d020036_T013:10 Zm00001d020036_T008:10 Zm00001d020036_T012:10 Zm00001d020036_T005:9 Zm00001d020036_T015:9 Zm00001d020036_T011:9 Zm00001d020036_T007:10 Zm00001d020036_T009:10 Zm00001d020036_T014:10 Zm00001d020036_T006:9 Zm00001d020036_T001:10 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.109216631 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
87424738-87404936(+) 87427367-87404856(+) |
Potential amino acid sequence |
MEKIRHVHSHIMESGSPEDEAGSEDNFVQGENGTSVANASIDPAQSLHGSNLSPPTVLQFGKTR KLSERSDPRNRQLLQKRQFFHSHRAQPMQLEQVFSDRDSEDEVDDDIADFEDRRMLDDFVDVTK DEKLIMHMWNSFVRKQRLRSGNVLFNYKYYNNTMQETEGCLSCF*(+) MLRLILLNLYMAAIFHHQQYYSLGRQGSYLRDLTLEIGNSCKNDSSSILTGRSQCNWSKCSRTV IVKMKLMMILLTSRIEECLMILLMLRKMKNLLCICGIHLFENKG*(+) |
Sponge-miRNAs | zma-miR482-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |