Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g083900.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000746 |
| Alias | 2:41738020|41740053 |
| Organism | Solanum lycopersicum |
| Position | chr2: 47160170-47162203 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc02g083900.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc02g083900.2.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.183027507 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
47162167-47161549(+) 47161535-47162173(-) |
| Potential amino acid sequence |
MSQSMHGQFQQGPCTGSSSFDLNVDRPFTSSPSSSNCGIVRLNVLNLPTKASKIRPNKILASSM DCWSTPFSKIGSTRFNIKRAHVVWMLSDKEASCMLLEKR*(+) MHDASLSLSIHTTCARLMLNLVEPIFEKGVDQQSMDEARILLGRILDAFVGKFNTFKRTIPQLL EEGEDVKGRSTLRSKLELPVQGPCWNWPCML*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |