Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0349200_circ_g.4 |
| ID in PlantcircBase | osa_circ_027494 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 16479410-16479687 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0349200 |
| Parent gene annotation |
Similar to AMP deaminase 1 (EC 3.5.4.6) (Myoadenylate deaminase) (AMP deaminase isoform M). (Os05t0349200-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0349200_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0349200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.375568675 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16479629-16479412(-) |
| Potential amino acid sequence |
MPTPEQWTNVFNPAFSYYAYYCYANLYTLNKLRESKGMTTIKFRPHAGEVVGLDLVDDESKPER RPTKHMPTPEQWTNVFNPAFSYYAYYCYANLYTLNKLRESKGMTTIKFRPHAGEVVGLDLVDDE SKPERRPTKHMPTPEQWTNVFNPAFSYYAYYCYANLYTLNKLRESKGMTTIKFRPHAGEVVGLD LVDDESKPERRPTKHMPTPEQWTNVFNPAFSYYAYYCYANLYTLNKLRESKGMTTIKFRPHAGE (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |