Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0502200_circ_g.4 |
ID in PlantcircBase | osa_circ_024464 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 25068801-25069847 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0502200 |
Parent gene annotation |
Transport protein Trs120 domain containing protein. (Os04t050220 0-01) |
Parent gene strand | + |
Alternative splicing | Os04g0502200_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0502200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005586* |
PMCS | 0.200781853 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25068832-25068879(+) 25068871-25069844(-) |
Potential amino acid sequence |
MFPPSDQQSLELHMLTMIQDLSASLLMEFEKWVLRAESTGTILKTPLDSQSSLGSEEVIKAKKR RLGRAQKIIGDYCLLAGSPADANAHYATAIELARLTGDVFWHAGALEGSVCALVVDRMAESDPV LEDEVKFRYYTIIQLYRRATLQDNAQSWCRKRGIILLCSLLLINNRWNFICSR*(+) MKFQRLLIRRREHNNIIPLFLHQL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |