Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G38695_circ_g.1 |
ID in PlantcircBase | ath_circ_017267 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 16178936-16179201 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT2G38695 |
Parent gene annotation |
unknown protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 5 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G38695.4:2 AT2G38695.1:2 AT2G38695.2:2 AT2G38695.3:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.16463562 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16179176-16179198(+) |
Potential amino acid sequence |
MGYLAAAERLLKKLKRYGLSGILSYGLLNTVYYSTAFLLVWFYVAPAPGKMGYLAAAERLLKKL KRYGLSGILSYGLLNTVYYSTAFLLVWFYVAPAPGKMGYLAAAERLLKKLKRYGLSGILSYGLL NTVYYSTAFLLVWFYVAPAPGKMGYLAAAE(+) |
Sponge-miRNAs | ath-miR396a-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |