Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G38695_circ_g.1 |
| ID in PlantcircBase | ath_circ_017267 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 16178936-16179201 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT2G38695 |
| Parent gene annotation |
unknown protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G38695.4:2 AT2G38695.1:2 AT2G38695.2:2 AT2G38695.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.16463562 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16179176-16179198(+) |
| Potential amino acid sequence |
MGYLAAAERLLKKLKRYGLSGILSYGLLNTVYYSTAFLLVWFYVAPAPGKMGYLAAAERLLKKL KRYGLSGILSYGLLNTVYYSTAFLLVWFYVAPAPGKMGYLAAAERLLKKLKRYGLSGILSYGLL NTVYYSTAFLLVWFYVAPAPGKMGYLAAAE(+) |
| Sponge-miRNAs | ath-miR396a-5p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |