Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d042470_circ_g.2 |
| ID in PlantcircBase | zma_circ_007701 |
| Alias | zma_circ_0001215 |
| Organism | Zea mays |
| Position | chr3: 168702704-168704243 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d042470 |
| Parent gene annotation |
Protein kinase superfamily protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d042470_circ_g.1 Zm00001d042470_circ_g.3 Zm00001d042470_circ_g.4 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d042470_T010:4 Zm00001d042470_T006:4 Zm00001d042470_T003:4 Zm00001d042470_T001:3 Zm00001d042470_T004:4 Zm00001d042470_T011:4 Zm00001d042470_T012:1 Zm00001d042470_T002:3 Zm00001d042470_T005:3 Zm00001d042470_T008:4 Zm00001d042470_T007:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.139548788 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
168702741-168702749(+) 168703108-168704126(-) |
| Potential amino acid sequence |
MAWVKRLVTLCDKAPATPFDVVRDVVEKQFMKNFDDIFEFFDVEPVGSASIAQVHRARLKLSNT DVAVKVQHPGAEHLMMVDIRNMQAMALFLQKYDINFDLFSATKEMEKQICYEFDFVREASAMER IREFLRITNKKPPVMVPRVIPGMVTRLLKFWGNLTWHLWLG*(+) MHLCNRSRPNRLNIEEFEYVIEILHELFLHNISNHIKWRGWGLVTQRNKSLHPSHRCQVRFPQN LSSLVTIPGITRGTITGGFLLVIRRNSRILSIALASRTKSNS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |