Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | EPlOSAG00000037954_circ_g.1 |
ID in PlantcircBase | osa_circ_043567 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 5633413-5633529 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | EPlOSAG00000037954 |
Parent gene annotation |
ncRNA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | AT-CA |
Number of exons covered | EPlOSAT00000039342:1 |
Conservation Information | |
---|---|
Conserved circRNAs |
ath_circ_051528 ath_circ_051611 ath_circ_051608 ath_circ_051526 ath_circ_051612 ath_circ_051527 |
PMCS | 0.906034829 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5633493-5633467(+) 5633423-5633415(-) |
Potential amino acid sequence |
MDWCGSSTPRTPDSGIELFCRRTSPTVSSPQ*(+) MPESGVLGVEEPHQSIPNLVVKLYCGDDTVGEVLRQNSSMPESGVLGVEEPHQSIPNLVVKLYC GDDTVGEVLRQNSSMPESGVLGVEEPHQSIPNLVVKLYCGDDTVGEVLRQNSSMPE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |