Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | EPlOSAG00000037954_circ_g.1 |
| ID in PlantcircBase | osa_circ_043567 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 5633413-5633529 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | EPlOSAG00000037954 |
| Parent gene annotation |
ncRNA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | AT-CA |
| Number of exons covered | EPlOSAT00000039342:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
ath_circ_051528 ath_circ_051611 ath_circ_051608 ath_circ_051526 ath_circ_051612 ath_circ_051527 |
| PMCS | 0.906034829 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5633493-5633467(+) 5633423-5633415(-) |
| Potential amino acid sequence |
MDWCGSSTPRTPDSGIELFCRRTSPTVSSPQ*(+) MPESGVLGVEEPHQSIPNLVVKLYCGDDTVGEVLRQNSSMPESGVLGVEEPHQSIPNLVVKLYC GDDTVGEVLRQNSSMPESGVLGVEEPHQSIPNLVVKLYCGDDTVGEVLRQNSSMPE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |