Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G22050_circ_g.5 |
| ID in PlantcircBase | ath_circ_039725 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 7302443-7302832 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, CIRI-full |
| Parent gene | AT5G22050 |
| Parent gene annotation |
Protein kinase superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT5G22050_circ_g.1 AT5G22050_circ_g.2 AT5G22050_circ_g.3 AT5G22050_circ_g.4 |
| Support reads | 9 |
| Tissues | root, inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G22050.1:3 AT5G22050.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.193538119 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7302666-7302829(+) |
| Potential amino acid sequence |
MLDENFTPKISDIRVNRHPKNHPKATHDSCSEDPLKTPLNWKTRIQIAIGVAAALEYLLVFSSN DAQIYDVSVNSCNIMLDENFTPKISDIRVNRHPKNHPKATHDSCSEDPLKTPLNWKTRIQIAIG VAAALEYLLVFSSNDAQIYDVSVNSCNIMLDENFTPKISDIRVNRHPKNHPKATHDSCSEDPLK TPLNWKTRIQIAIGVAAALEYLLVFSSNDAQIYDVSVNSCNIMLDENFTPKISDIRVNRHPKNH PKATHDSCSE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |