Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0577900_circ_g.2 |
| ID in PlantcircBase | osa_circ_008183 |
| Alias | Os10circ10937/Os_ciR6926 |
| Organism | Oryza sativa |
| Position | chr10: 23045311-23045764 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os10g0577900 |
| Parent gene annotation |
Similar to Glycerol-3-phosphate acyltransferase (Fragment). (Os1 0t0577900-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2/2 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0577900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008752 |
| PMCS | 0.249993612 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23045495-23045743(+) 23045319-23045535(-) |
| Potential amino acid sequence |
MQSRDPNAHDIVLSNMVALFDCVLLDVENPFTFPPYHKAVREPFDYYMFGQNYIRPLVDYRAHF AYQKGSGEREAACRCRCQSRRAILQLQGRGYAEQGSKCTRHRAFKHGGPVRLCSARCRESVYLS ALSQSCQGTIRLLHVWSELH*(+) MSSIVYKGPNVVLTKHVIVEWFPDSFVIRRKGKRILYIEQNTIEQGHHV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |