Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0577900_circ_g.2 |
ID in PlantcircBase | osa_circ_008183 |
Alias | Os10circ10937/Os_ciR6926 |
Organism | Oryza sativa |
Position | chr10: 23045311-23045764 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os10g0577900 |
Parent gene annotation |
Similar to Glycerol-3-phosphate acyltransferase (Fragment). (Os1 0t0577900-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/2/2 |
Tissues | leaf/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0577900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008752 |
PMCS | 0.249993612 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23045495-23045743(+) 23045319-23045535(-) |
Potential amino acid sequence |
MQSRDPNAHDIVLSNMVALFDCVLLDVENPFTFPPYHKAVREPFDYYMFGQNYIRPLVDYRAHF AYQKGSGEREAACRCRCQSRRAILQLQGRGYAEQGSKCTRHRAFKHGGPVRLCSARCRESVYLS ALSQSCQGTIRLLHVWSELH*(+) MSSIVYKGPNVVLTKHVIVEWFPDSFVIRRKGKRILYIEQNTIEQGHHV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |