Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0684400_circ_g.4 |
ID in PlantcircBase | osa_circ_021011 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 27291610-27292324 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0684400 |
Parent gene annotation |
Mg2+ transporter protein, CorA-like domain containing protein. ( Os03t0684400-01) |
Parent gene strand | + |
Alternative splicing | Os03g0684400_circ_g.5 Os03g0684400_circ_g.6 Os03g0684400_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0684400-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013435 |
PMCS | 0.211941469 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27291804-27291643(+) 27291690-27292322(-) |
Potential amino acid sequence |
MLIDLLDDPHEIRRICIMGRNCTLDKLSDNMECSVPLEKQIAEEEEEEIEMLLENYLQRCESIH GQAERLLDSAREMEDSIAVNLRWVLCLKFYQIG*(+) MLVCLDEAAPTHQLSTDLVELQAKHPP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |