Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0617900_circ_g.1 |
ID in PlantcircBase | osa_circ_012337 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 26308363-26308562 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0617900 |
Parent gene annotation |
Similar to Serine/threonine protein phosphatase. (Os12t0617900-0 1);Similar to Serine/threonine protein phosphatase BSL2 (EC 3.1. 3.16) (BSU1-like protein 2). (Os12t0617900-02);Similar to Serine /threonine protein phosphatase. (Os12t0617900-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0617900-03:1 Os12t0617900-02:1 Os12t0617900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.683751875 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26308529-26308402(+) 26308534-26308413(+) 26308531-26308528(-) |
Potential amino acid sequence |
MRCQVQIPSRSPTEDPLEQPSLLPW*(+) MPGPDPITLTHRRSIRTTEPASMVIGL*(+) MNRLFNWLPLAALIEKKIICMHGGIGRSINHVEQIENLQRPITMEAGSVVLMDLLWVSVMGSGP GIA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |