Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0924900_circ_g.1 |
ID in PlantcircBase | osa_circ_005591 |
Alias | Os_ciR2648 |
Organism | Oryza sativa |
Position | chr1: 40503260-40503988 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0924900 |
Parent gene annotation |
GTP-binding signal recognition particle SRP54, G-domain containi ng protein. (Os01t0924900-01);Similar to BRI1-KD interacting pro tein 112 (Fragment). (Os01t0924900-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 5/3 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0924900-01:5 Os01t0924900-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011133 |
PMCS | 0.141776646 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40503661-40503467(+) 40503320-40503316(+) |
Potential amino acid sequence |
MFPEQPQRRRKSLPNYWNFWSPLASLEMLFSLMIRKGRNVEGDLKEMARRLLKALLMGSSIQTI KKKGRREPAKSSCFNVWKKIKCPFLEEKHIPIFWFCLD*(+) MYGRKSNVHFLKRNISQFSGFVWTDNQEKQRTRIKEKLDKFNKEKLLDFCEILDIHVSRAATKK EEVSAKLLEFLESPCITRDVVLTDDKKGKKRGRRSKGNGQATAEGASDGKFNSNYQKERQTRTC KVFMF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |