Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0924900_circ_g.1 |
| ID in PlantcircBase | osa_circ_005591 |
| Alias | Os_ciR2648 |
| Organism | Oryza sativa |
| Position | chr1: 40503260-40503988 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0924900 |
| Parent gene annotation |
GTP-binding signal recognition particle SRP54, G-domain containi ng protein. (Os01t0924900-01);Similar to BRI1-KD interacting pro tein 112 (Fragment). (Os01t0924900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5/3 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0924900-01:5 Os01t0924900-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011133 |
| PMCS | 0.141776646 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40503661-40503467(+) 40503320-40503316(+) |
| Potential amino acid sequence |
MFPEQPQRRRKSLPNYWNFWSPLASLEMLFSLMIRKGRNVEGDLKEMARRLLKALLMGSSIQTI KKKGRREPAKSSCFNVWKKIKCPFLEEKHIPIFWFCLD*(+) MYGRKSNVHFLKRNISQFSGFVWTDNQEKQRTRIKEKLDKFNKEKLLDFCEILDIHVSRAATKK EEVSAKLLEFLESPCITRDVVLTDDKKGKKRGRRSKGNGQATAEGASDGKFNSNYQKERQTRTC KVFMF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |