Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G055000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000242 |
| Alias | Chr03:8582870|8586034 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 8582870-8586034 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G055000 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G055000.1:5 Gorai.003G055000.5:4 Gorai.003G055000.4:4 Gorai.003G055000.7:4 Gorai.003G055000.2:5 Gorai.003G055000.6:4 Gorai.003G055000.3:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.431686588 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8582873-8585932(-) |
| Potential amino acid sequence |
MVIEKNRNTYLRLMEQRKGSVCSRHSCWMRELLIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |