Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G78070_circ_g.4 |
| ID in PlantcircBase | ath_circ_010728 |
| Alias | At_ciR412, Ath_circ_FC1055 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 29357085-29357413 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT1G78070 |
| Parent gene annotation |
At1g78070/F28K19_28 |
| Parent gene strand | + |
| Alternative splicing | AT1G78070_circ_g.1 AT1G78070_circ_g.2 AT1G78070_circ_g.3 AT1G78070_circ_g.5 AT1G78070_circ_g.6 |
| Support reads | 56 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G78070.1:2 AT1G78070.3:2 AT1G78070.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.316171326 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29357130-29357410(+) |
| Potential amino acid sequence |
MNNYSLMHWSSLLQRGKEVLNVAKPIVPSMKQHGSLSQSVSRVQISTMAVKDDLIVAGGFQGEL ICKLRNLVWATSKHDVYFMNNYSLMHWSSLLQRGKEVLNVAKPIVPSMKQHGSLSQSVSRVQIS TMAVKDDLIVAGGFQGELICKLRNLVWATSKHDVYFMNNYSLMHWSSLLQRGKEVLNVAKPIVP SMKQHGSLSQSVSRVQISTMAVKDDLIVAGGFQGELICKLRNLVWATSKHDVYFMNNYSLMHWS SLLQRGKEVLNVAKPIVPSMKQHGSLSQSVSRVQISTMAVKDDLIVAGGFQGELICK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chen et al., 2017a |